The short version of Pharmacokinetics fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-02-12 and is reviewed periodically as new material appears.
Development of the peptide passed through several delivery formats, including an intranasal version tested in early trials and an injectable version that entered later clinical study. Regulatory approval for a subcutaneous product in the United States was granted in 2019 after review of controlled trials in premenopausal women. Outside the clinic, the compound circulates in research and non-pharmaceutical markets under its code name, where identity and purity vary considerably between suppliers. Synonyms appearing across technical literature include bremelanotide, PT-141, and Palatin 141.
PT-141 is the research designation for bremelanotide, a synthetic cyclic heptapeptide developed as a melanocortin receptor agonist. The peptide contains seven amino acids with an internal lactam bridge that constrains the backbone into a stable ring. Cyclisation of this kind improves resistance to enzymatic degradation relative to linear analogues. The compound was first explored for effects on melanin production, because several melanocortin receptors influence pigmentation. Its later association with sexual desire emerged from observations made during that early work, and the molecule became the subject of a separate development programme.
Bremelanotide is a moderately large peptide with a molecular mass near 1025 daltons. In lyophilised form it appears as a white to off-white powder and is freely soluble in water and other polar solvents. The intact lactam ring is essential for receptor affinity, while linearised fragments bind far more weakly. Solutions are sensitive to extremes of pH and to prolonged exposure to light and heat, so handling typically involves buffered conditions and cold storage. Its short plasma half-life reflects rapid distribution and clearance rather than chemical breakdown inside the vial.
Published discussion sits at the intersection of peptide chemistry, neuroendocrinology and sexual medicine. Trial reports emphasise change scores on validated instruments, while mechanistic papers focus on hypothalamic circuits and receptor selectivity. Because placebo response in this field is large, effect sizes are usually reported with confidence intervals rather than as isolated averages. Reviews note that female and male data sets are not interchangeable and should be read separately. Diagnostic terminology has been revised over time, which complicates comparison between older and newer studies.
Bremelanotide is a synthetic cyclic heptapeptide that acts on a family of G-protein-coupled receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide associated with pigmentation and several central signalling pathways. A lactam bridge constrains the ring and slows enzymatic breakdown, which distinguishes it from the linear parent molecule. Research interest moved over time from pigment biology toward central nervous system effects, particularly circuits connected to sexual desire. Parenteral delivery is used because oral bioavailability is poor.
Early clinical work used an intranasal formulation, and later programmes switched to subcutaneous delivery for more consistent absorption. A subcutaneous product received regulatory approval in the United States in 2019 for premenopausal women with acquired, generalised hypoactive sexual desire disorder. Approval followed phase 3 trials in which active treatment separated from placebo on desire and distress measures, though the average difference was modest. Labeling carries a caution about transient blood pressure elevation, so cardiovascular history is assessed before prescribing. Questions about durability of benefit beyond several months remain open.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Cyclic heptapeptide | Synthetic melanocortin analogue |
| Molecular formula | C50H68N14O10 | Corresponds to a mass near 1025 daltons |
| Appearance | White to off-white powder | Lyophilised solid before reconstitution |
| Solubility | Soluble in water and polar solvents | Poor solubility in nonpolar media |
| Common synonyms | Bremelanotide, PT-141 | Code name and international name used interchangeably |
Certificate of analysis documents usually report purity percentage, molecular weight, and appearance. Researchers verify identity by comparing observed and theoretical mass values. Chain-of-custody records and batch numbers help trace material from source to experiment. Independent verification of supplier claims is considered good practice when material identity is critical to a study. Records should include the storage history of each aliquot, and unexpected deviations in appearance or solubility warrant re-testing before use.
Lyophilized peptide material is generally stored at -20 °C or below to limit degradation, while reconstituted solutions are less stable and are typically kept refrigerated and protected from light. Repeated freeze-thaw cycles can accelerate aggregation and should be minimized. Stability for any specific lot depends on purity, moisture content, and packaging. Handling in a temperature-controlled environment reduces variability across replicates, and exposure to ambient humidity during weighing can introduce error. Aliquotting reduces the number of times a stock container is opened.
Reverse-phase high-performance liquid chromatography is the standard method for assessing purity. Mass spectrometry confirms molecular identity and detects sequence variants or truncation products. Ultraviolet absorbance at 214 or 280 nm is used for quantification, with the choice depending on the peptide sequence. Method validation typically addresses linearity, limit of detection, and precision across a defined concentration range. Impurity profiling may also employ ion-exchange or size-exclusion chromatography, and these techniques complement one another.
After subcutaneous administration, plasma concentrations rise within roughly thirty minutes and the elimination half-life is short, on the order of two to three hours. Reported physiological responses include transient increases in blood pressure and nausea, which tended to diminish with repeated dosing in trial settings. Because the peptide clears quickly, effects are not expected to persist long after a dose. Absorption from non-injected routes is poorly characterised, and nasal delivery produced variable plasma levels in older work.
Clinical research typically uses randomised, double-blind, placebo-controlled designs. The most common primary endpoint is the desire domain score of the Female Sexual Function Index, sometimes paired with a distress measure. Secondary outcomes include arousal, satisfaction, and event-based counts of satisfying sexual episodes. Across trials, average improvements are modest and individual responses vary widely. Whether benefits persist beyond a few months, and whether they depend on baseline hormone status, remain open questions rather than settled findings.
Melanocortin receptors form a family of five G-protein-coupled receptors designated MC1 through MC5. Bremelanotide binds most strongly at MC4R and MC1R, with weaker activity reported at MC3R and MC5R. MC4R is expressed in hypothalamic nuclei that coordinate energy balance and aspects of sexual behaviour. The prevailing interpretation is that central MC4R activation, rather than peripheral vascular effects alone, drives the reported changes in desire. This account remains partly inferential, since direct receptor-level measurement in living humans is not practical.
From a pharmacokinetic standpoint, the peptide is usually delivered by injection because oral bioavailability is very low; proteases in the digestive tract degrade it rapidly. After subcutaneous administration, plasma concentrations reach a peak within roughly one hour. Its elimination half-life is relatively short, with most reports placing it in the range of a few hours. Nasal formulations have also been examined, though absorption varies widely between individuals. Metabolism proceeds mainly through peptidase cleavage, and the resulting products are excreted by the kidneys.
PT-141 initiates cellular signaling by binding to specific subtypes within the melanocortin receptor family. These receptors belong to the G protein-coupled receptor superfamily, and activation raises intracellular cyclic adenosine monophosphate levels. This cascade ultimately influences neuronal circuits in the central nervous system that are associated with sexual desire and arousal. Research indicates the compound's action concentrates in hypothalamic regions rather than peripheral tissues, which helps explain some observed pharmacological features. The selectivity of receptor binding underlies its functional differences.
Outside the approved product, bremelanotide circulates as a research chemical sold by peptide vendors, often labelled PT-141. Such material is not manufactured under pharmaceutical quality standards, and independent testing has repeatedly found content that differs from the label. Analytical certificates supplied with a purchase are not strong evidence of purity because they are usually generated by the seller. Online discussion tends to blur the distinction between the approved drug and unregulated powder, which complicates interpretation of reported experiences.
PT-141 is the original development code for bremelanotide, a synthetic peptide first studied as a potential tanning and sexual-response agent in the 1990s. Researchers at a small American biotechnology firm designed it as a shortened analogue of melanotan II, which itself came from work on alpha-melanocyte-stimulating hormone. Early screening focused on pigmentation, but behavioural observations in animal models redirected attention toward sexual motivation. That shift made PT-141 one of the first melanocortin compounds investigated specifically for effects on desire rather than on skin colour.
=== Mechanism === RIP causes G:C to A:T transition mutations within repeats, however, the mechanism that detects the repeated sequences is unknown. RID is the only known protein essential for RIP. It is a DNA methyltransferease-like protein, that when mutated or knocked out results in loss of RIP. Deletion of the rid homolog in Aspergillus nidulans, dmtA, results in loss of fertility while deletion of the rid homolog in Ascobolus immersens, masc1, results in fertility defects and loss of methylation induced premeiotically (MIP).
The seventh generation Familia (BG) included three-door hatchback, five-door liftback, and four-door saloon variants, none of which share any body panels. The new five-door liftback version was called the Familia Astina in Japan and was sold as the 323F or 323 Astina elsewhere. The BF wagon (originally introduced in 1985) was carried over in facelifted form, although Ford marketed a wagon on the new platform as part of the North American Escort line. The BG Familia was available with front- or all-wheel drive and 1.3–1.8 L petrol engines or a 1.7 L diesel engine. Later, a turbocharged engine was added, especially developed for homologation purposes for the World Rally Championship (WRC), Group A category. The all-wheel drive models (including the turbocharged GT-X) were introduced in August 1989. In Japan, the 1.6 L SOHC was only available coupled to all-wheel drive. With a carburettor, it offered 91 PS (67 kW; 90 hp), the same as the lower-spec 1.5 L SOHC, but with a somewhat larger torque curve. In Europe, only the 1.8 L SOHC (in naturally aspirated, 106 PS (78 kW; 105 hp) form or either of the turbocharged variants) was offered with four-wheel-drive. Trim lines in Japan included "Clair", "Pepper", "Interplay", "Supreme", "GT", "GT-X" and "GT-R". The Supreme model was only available in saloon form and features the larger bumpers and bootlid-mounted number plate recess of the American market Protegé. Carburetted models were mostly dropped in the 1991 facelift, replaced by single-point fuel injection.
Mathematical descriptions of protein-DNA binding taking into account sequence-specificity, and competitive and cooperative binding of proteins of different types are usually performed with the help of the lattice models. Computational methods to identify the DNA binding sequence specificity have been proposed to make a good use of the abundant sequence data in the post-genomic era. In addition, progress has happened on structure-based prediction of binding specificity across protein families using deep learning.
2024 United States elections 2024 United States gubernatorial elections 2024 United States House of Representatives elections 2024 United States Senate elections Timeline of the 2024 United States presidential election Republican Party efforts to disrupt the 2024 United States presidential election Fundraising in the 2024 United States presidential election
=== EC 1.17.98 With other, known, physiological acceptors === EC 1.17.98.1: bile-acid 7α-dehydroxylase. Now known to be catalyzed by multiple enzymes. EC 1.17.98.2: bacteriochlorophyllide c C-71-hydroxylase EC 1.17.98.3: formate dehydrogenase (coenzyme F420) EC 1.17.98.4: formate dehydrogenase (hydrogenase)
Sources: en.wikipedia.org
=== Connective Tissue === The apical foramen is lined by connective tissue that is loosely organised, in which is continuous with the dental pulp and periodontal ligament. This tissue contains fibroblasts, collagen fibres, blood vessels and nerve fibres, as well as occasional immune cells such as macrophages. There is no epithelium in the apical foramen.
=== Acute kidney impairment === Acute kidney impairment is one of the more complicated complications of Rhabdomyolysis. The risk of kidney injuries is increased from factors such as hypovolemia, abnormalities from electrolytes, and the severity of muscle injury. Kidney dysfunction typically develops 1–2 days after the initial muscle damage. If supportive treatment is inadequate to manage this, renal replacement therapy (RRT) may be required. RRT removes excess potassium, acid, and phosphate that accumulate when the kidneys are unable to function normally and is required until kidney function is regained. Three main modalities of RRT are available: hemodialysis, continuous hemofiltration and peritoneal dialysis. The former two require access to the bloodstream (a dialysis catheter), and peritoneal dialysis is achieved by instilling fluid into the abdominal cavity and later draining it. Hemodialysis, which is normally done several times a week in chronic kidney disease, is often required daily in rhabdomyolysis. Its advantage over continuous hemofiltration is that one machine can be used multiple times a day, and that continuous administration of anticoagulant drugs is not necessary. Hemofiltration is more effective at removing large molecules from the bloodstream, such as myoglobin, but this does not seem to confer any particular benefit. Peritoneal dialysis may be difficult to administer in someone with severe abdominal injury, and it may be less effective than the other modalities.
Photorespiration (also known as the oxidative photosynthetic carbon cycle or C2 cycle) refers to a process in plant metabolism where the enzyme RuBisCO oxygenates ribulose 1,5-bisphosphate (RuBP), wasting some of the energy produced by photosynthesis. The desired reaction is the addition of carbon dioxide to RuBP (carboxylation), a key step in the Calvin–Benson cycle, but approximately 25% of reactions by RuBisCO instead add oxygen to RuBP (oxygenation), creating a product that cannot be used within the Calvin–Benson cycle. This process lowers the efficiency of photosynthesis, potentially lowering photosynthetic output by 25% in C3 plants. Photorespiration involves a complex network of enzyme reactions that exchange metabolites between chloroplasts, leaf peroxisomes and mitochondria. The oxygenation reaction of RuBisCO is a wasteful process because 3-phosphoglycerate is created at a lower rate and higher metabolic cost compared with RuBP carboxylase activity. While photorespiratory carbon cycling results in the formation of G3P eventually, around 25% of carbon fixed by photorespiration is re-released as CO2 and nitrogen, as ammonia. Ammonia must then be detoxified at a substantial cost to the cell. Photorespiration also incurs a direct cost of one ATP and one NAD(P)H. While it is common to refer to the entire process as photorespiration, technically the term refers only to the metabolic network which acts to rescue the products of the oxygenation reaction (phosphoglycolate).
== See also == Buried penis Castration anxiety Crotch (in clothing) – a pouch-shaped area built to accommodate a penis and scrotum Micropenis Penile enlargement Penis removal Phallic architecture Phallus – an object or image that resembles a penis Preputioplasty – an operation performed to facilitate retraction of the foreskin Stunt cock – a substitute penis used for filmmaking
Jeremy Corbyn is ejected from the Labour Party after announcing he will stand as an independent candidate in the Islington North constituency, which he has represented since 1983. Parliament is prorogued ahead of the general election. The Tobacco and Vapes Bill is not among legislation to be rushed through Parliament before its prorogation. The Renters (Reform) Bill, which would have brought in an end to no-fault evictions, is also shelved. But the Post Office (Horizon System) Offences Bill, which quashes the convictions of sub-postmasters convicted in the Horizon scandal in England, Wales and Northern Ireland is passed, as is the Pet Abduction Bill, making the abduction of cats and dogs a criminal offence from August. The Victims and Prisoners Bill is also passed into law. The Media Act 2024 receives Royal assent following its approval by Parliament the previous day. Jonathan Buckley is selected as the Democratic Unionist Party candidate for Lagan Valley following the departure of Sir Jeffrey Donaldson. 27 May – Outgoing MP Lucy Allan endorses Reform UK and is suspended from the Conservative Party. Barbara Keeley, MP for Worsley and Eccles South, announces her retirement from Parliament. John Spellar, MP for Warley, announces his retirement from Parliament. Kevin Brennan, MP for Cardiff West, announces he is standing down from Parliament at the election. 28 May – The Times publishes a letter signed by 121 prominent business figures endorsing the Labour Party. Diane Abbott has the Labour Party whip restored following its suspension in April 2023.
Sources: en.wikipedia.org
The tournament will be hosted by whoever wins the regular season title. Right now, either James Madison or Old Dominion will host the tournament, depending on their regular season outcomes. Last updated: October 31, 2011Source: NMN Athletics Colonial Athletic Association 2011 CAA Men's Soccer Tournament 2011 NCAA Division I men's soccer season 2011 NCAA Division I Men's Soccer Championship
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Calcium cycling provides a link between tectonics, climate, and the carbon cycle. In the simplest terms, mountain-building exposes calcium-bearing rocks such as basalt and granodiorite to chemical weathering and releases Ca2+ into surface water. These ions are transported to the ocean where they react with dissolved CO2 to form limestone (CaCO3), which in turn settles to the sea floor where it is incorporated into new rocks. Dissolved CO2, along with carbonate and bicarbonate ions, are termed "dissolved inorganic carbon" (DIC). The actual reaction is more complicated and involves the bicarbonate ion (HCO−3) that forms when CO2 reacts with water at seawater pH:
== Family members == Prokaryotes express three Hsp70 proteins: DnaK, HscA (Hsc66), and HscC (Hsc62). Eukaryotic organisms express several slightly different Hsp70 proteins. All share the common domain structure, but each has a unique pattern of expression or subcellular localization. These are, among others:
Sources: en.wikipedia.org
PT-141 is a laboratory code for bremelanotide, a synthetic peptide that activates melanocortin receptors. It has been developed both as an injectable pharmaceutical product and as a research chemical. The two contexts differ sharply in how identity, purity, and dosing are controlled.
It is neither a steroid nor a naturally occurring human hormone. Bremelanotide is a manufactured peptide that mimics part of the melanocortin signalling system by binding receptor proteins. Its effects come from receptor activation, not from replacing a circulating hormone.
The internal lactam bridge locks the peptide into a defined shape, which raises receptor affinity and slows enzymatic breakdown. Linear versions of the same sequence are less stable and bind more weakly. Ring geometry is therefore central to how the molecule behaves in the body.
It is a synthetic cyclic peptide that activates melanocortin receptors. It is given by injection and was approved in the United States in 2019 for a specific low-desire diagnosis in premenopausal women. It is not a hormonal therapy.